PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016650765.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 351aa    MW: 39264 Da    PI: 5.2545
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016650765.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1561.7e-4861341129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrF+Ptd elv +yLk+kv gk+l++ ++i+evdi+k+ PwdLp k   ++++ +wyfF+++++ky+tg r +r t+ gyWk+tgkd++vl
  XP_016650765.1   6 LPPGFRFSPTDVELVRYYLKRKVMGKRLHF-NFIAEVDIHKYAPWDLPeKsGWQSGDLKWYFFCPTARKYPTGVRVQRGTECGYWKSTGKDRSVL 99 
                     79**************************99.99**************94345566778************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       ++e+ g kk+L+f+kgr+pkge+tdWvmheyrle
  XP_016650765.1 100 Y-NSEVSGWKKILIFHKGRSPKGERTDWVMHEYRLE 134
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-563156IPR003441NAC domain
PROSITE profilePS5100553.7336156IPR003441NAC domain
PfamPF023659.5E-257133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGKPPLPPGF RFSPTDVELV RYYLKRKVMG KRLHFNFIAE VDIHKYAPWD LPEKSGWQSG  60
DLKWYFFCPT ARKYPTGVRV QRGTECGYWK STGKDRSVLY NSEVSGWKKI LIFHKGRSPK  120
GERTDWVMHE YRLEAKDLAD SGVPHDSYVI CMIFQKDGWG PKNGAQYGAP FKEEDWTDDE  180
AEICSEAVPH ENMSELNLVV QSNCNSSVTT SGHSPKGIHI GPSESCISDV LPPSCNVLQL  240
VSSNHVTIEK LHGSDGDILS MLNCFTEGST SLMKVNDKNE ELGNVIHSGN ASATPNVNSD  300
DIYEDLGDLG KMAKVSEDGY NFSNVHNSIC APAQMQLGDN EQFLELDDLS W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-43615615168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204688.10.0hypothetical protein PRUPE_ppa007785mg
TrEMBLM5VWT70.0M5VWT7_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.15e-94NAC domain containing protein 103